SCOPe 2.07: Domain d6lhha1: 6lhh A:4-181

Lineage for d6lhha1 (6lhh A:4-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225828] (13 PDB entries)

8. Domain d6lhha1: 6lhh A:4-181 [395212]
   Other proteins in same PDB: d6lhha2, d6lhhb_
   automated match to d1zaga2

Details for d6lhha1

PDB Entry: 6lhh, 2.71 Å

PDB Description: crystal structure of chicken 8mer-bf2*1501

PDB Compounds: (A:) MHC class I

SCOPe Domain Sequences for d6lhha1:

Sequence; same for both SEQRES and ATOM records:

>d6lhha1 d.19.1.0 (A:4-181) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elhtlryistamtdpgpgqpwyvdvgyvdgelfthynstarravprtewiaantdqqywd
setqtsqrteqidrdglgtlqrrynqtggshtvqlmygcdiledgtirgysqdaydgrdf
iafdkdtmtftaavpeavptkrkweegdyaeglkqyleetcvewlrryveygkaelgr

Timeline for d6lhha1:

• d6lhha1 is new in SCOPe 2.07-stable
  
• d6lhha1 appears in the current release, SCOPe 2.08