Lineage for d4gep_2 (4gep 346-425)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33189Superfamily d.58.36: Sulfite reductase, domains 1 and 3 [55124] (1 family) (S)
  5. 33190Family d.58.36.1: Sulfite reductase, domains 1 and 3 [55125] (1 protein)
  6. 33191Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)
  7. 33192Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)
  8. 33206Domain d4gep_2: 4gep 346-425 [39520]
    Other proteins in same PDB: d4gep_3, d4gep_4

Details for d4gep_2

PDB Entry: 4gep (more details), 2 Å

PDB Description: sulfite reductase hemoprotein cyanide complex reduced with crii edta

SCOP Domain Sequences for d4gep_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gep_2 d.58.36.1 (346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

SCOP Domain Coordinates for d4gep_2:

Click to download the PDB-style file with coordinates for d4gep_2.
(The format of our PDB-style files is described here.)

Timeline for d4gep_2: