SCOPe 2.08: Domain d6l61b2: 6l61 B:236-389

Lineage for d6l61b2 (6l61 B:236-389)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Aegle marmelos [TaxId:68527] [395033] (6 PDB entries)

8. Domain d6l61b2: 6l61 B:236-389 [395199]
   automated match to d3wd7a2

Details for d6l61b2

PDB Entry: 6l61, 1.4 Å

PDB Description: quinolone synthase from aegle marmelos correa, dimer

PDB Compounds: (B:) Type III polyketide synthase

SCOPe Domain Sequences for d6l61b2:

Sequence; same for both SEQRES and ATOM records:

>d6l61b2 c.95.1.0 (B:236-389) automated matches {Aegle marmelos [TaxId: 68527]}
lyhivsasqtllpdsdgaieghireagltvhlkkdvpaffsaniekslvdaftpigisdw
nsifwiahpggpaildqveeklglrkdklkasrhvmsefgnmssacvlfildemrktcle
egkattgegldwgvlfgfgpgltvetvvlrsvpi

Timeline for d6l61b2:

• d6l61b2 first appeared in SCOPe 2.07