| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) ![]() Toxin component of plasmid stabilisation system |
| Family d.298.1.0: automated matches [191658] (1 protein) not a true family |
| Protein automated matches [191236] (7 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93061] [390036] (3 PDB entries) |
| Domain d6l8gb_: 6l8g B: [395156] automated match to d2a6sb_ |
PDB Entry: 6l8g (more details), 1 Å
SCOPe Domain Sequences for d6l8gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l8gb_ d.298.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
arlnitfspqafedykyfqqndkkmvkkinellksidrngalegigkpeklksnltgyys
rrinhehrlvytvddnhikiasckyhy
Timeline for d6l8gb_: