Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries) |
Domain d6l9md1: 6l9m D:0-181 [395133] Other proteins in same PDB: d6l9ma2, d6l9mb_, d6l9md2, d6l9me_, d6l9mg2, d6l9mh_, d6l9mj2, d6l9mk_ automated match to d1kjva2 |
PDB Entry: 6l9m (more details), 2.6 Å
SCOPe Domain Sequences for d6l9md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9md1 d.19.1.1 (D:0-181) automated matches {Human (Homo sapiens) [TaxId: 9606]} agphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpey weritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfayd gcdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatl lr
Timeline for d6l9md1: