SCOPe 2.08: Domain d6l9md1: 6l9m D:0-181

Lineage for d6l9md1 (6l9m D:0-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d6l9md1: 6l9m D:0-181 [395133]
   Other proteins in same PDB: d6l9ma2, d6l9mb_, d6l9md2, d6l9me_, d6l9mg2, d6l9mh_, d6l9mj2, d6l9mk_
   automated match to d1kjva2

Details for d6l9md1

PDB Entry: 6l9m, 2.6 Å

PDB Description: h2-ld complexed with ah1 peptide

PDB Compounds: (D:) H2-Ld

SCOPe Domain Sequences for d6l9md1:

Sequence; same for both SEQRES and ATOM records:

>d6l9md1 d.19.1.1 (D:0-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpey
weritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfayd
gcdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatl
lr

Timeline for d6l9md1:

• d6l9md1 first appeared in SCOPe 2.07