SCOPe 2.08: Domain d7krxa2: 7krx A:62-314

Lineage for d7krxa2 (7krx A:62-314)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (34 PDB entries)

8. Domain d7krxa2: 7krx A:62-314 [395126]
   Other proteins in same PDB: d7krxa1
   automated match to d4m0wa2
   complexed with act, cl, unx, y41, zn; mutant

Details for d7krxa2

PDB Entry: 7krx, 2.72 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2, c111s mutant, in complex with plp_snyder441 inhibitor

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d7krxa2:

Sequence, based on SEQRES records:

>d7krxa2 d.3.1.23 (A:62-314) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnnsylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensyttti

Sequence, based on observed residues (ATOM records):

>d7krxa2 d.3.1.23 (A:62-314) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnnsylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcqatkylvqqespfvm
msappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpitdv
fykensyttti

Timeline for d7krxa2:

• d7krxa2 first appeared in SCOPe 2.07