Lineage for d3geo_1 (3geo 81-145)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33189Superfamily d.58.36: Sulfite reductase, domains 1 and 3 [55124] (1 family) (S)
  5. 33190Family d.58.36.1: Sulfite reductase, domains 1 and 3 [55125] (1 protein)
  6. 33191Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)
  7. 33192Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)
  8. 33209Domain d3geo_1: 3geo 81-145 [39511]
    Other proteins in same PDB: d3geo_3, d3geo_4

Details for d3geo_1

PDB Entry: 3geo (more details), 2.1 Å

PDB Description: sulfite reductase hemoprotein nitrite complex

SCOP Domain Sequences for d3geo_1:

Sequence, based on SEQRES records: (download)

>d3geo_1 d.58.36.1 (81-145) Sulfite reductase, domains 1 and 3 {Escherichia coli}
llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsv
gldal

Sequence, based on observed residues (ATOM records): (download)

>d3geo_1 d.58.36.1 (81-145) Sulfite reductase, domains 1 and 3 {Escherichia coli}
llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilpvhqmlhsvgldal

SCOP Domain Coordinates for d3geo_1:

Click to download the PDB-style file with coordinates for d3geo_1.
(The format of our PDB-style files is described here.)

Timeline for d3geo_1: