Lineage for d6l9je_ (6l9j E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306178Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233791] (2 PDB entries)
  8. 2306181Domain d6l9je_: 6l9j E: [395108]
    automated match to d5gjka_
    complexed with gol

Details for d6l9je_

PDB Entry: 6l9j (more details), 2.64 Å

PDB Description: structure of yeast snf5 and swi3 subcomplex
PDB Compounds: (E:) SWI/SNF complex subunit SWI3

SCOPe Domain Sequences for d6l9je_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9je_ a.4.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pqaheivipsyskwfnlekihsievqslpefftnripsktpevymryrnfmvnsyrlnpn
eyfsvttarrnvsgdaaalfrlhkfltkwglinyqvdsk

SCOPe Domain Coordinates for d6l9je_:

Click to download the PDB-style file with coordinates for d6l9je_.
(The format of our PDB-style files is described here.)

Timeline for d6l9je_: