Lineage for d5aopa2 (5aop A:346-425)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863885Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. 863886Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (3 proteins)
  6. 863901Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)
  7. 863902Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)
  8. 863920Domain d5aopa2: 5aop A:346-425 [39510]
    Other proteins in same PDB: d5aopa3, d5aopa4
    complexed with fs4, k, srm

Details for d5aopa2

PDB Entry: 5aop (more details), 2.2 Å

PDB Description: sulfite reductase structure reduced with crii edta, 5-coordinate siroheme, siroheme feii, [4fe-4s] +1
PDB Compounds: (A:) sulfite reductase hemoprotein

SCOP Domain Sequences for d5aopa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aopa2 d.58.36.1 (A:346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

SCOP Domain Coordinates for d5aopa2:

Click to download the PDB-style file with coordinates for d5aopa2.
(The format of our PDB-style files is described here.)

Timeline for d5aopa2: