SCOPe 2.08: Domain d7kfyl2: 7kfy L:107-214

Lineage for d7kfyl2 (7kfy L:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7kfyl2: 7kfy L:107-214 [395080]
   Other proteins in same PDB: d7kfya_, d7kfyh_, d7kfyl1
   automated match to d1dn0a2
   complexed with nag

Details for d7kfyl2

PDB Entry: 7kfy, 2.16 Å

PDB Description: structural basis for a germline-biased antibody response to sars-cov-2 (rbd:c1a-f10 fab)

PDB Compounds: (L:) light chain of human antibody C1A-F10 Fab

SCOPe Domain Sequences for d7kfyl2:

Sequence; same for both SEQRES and ATOM records:

>d7kfyl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d7kfyl2:

• d7kfyl2 first appeared in SCOPe 2.07