SCOP 1.75: Domain d3aopa2: 3aop A:346-425

Lineage for d3aopa2 (3aop A:346-425)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families)
   duplication: contains two subdomains of this fold

5. Family d.58.36.1: Duplicated SiR/NiR-like domains 1 and 3 [55125] (3 proteins)

6. Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)

7. Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)

8. Domain d3aopa2: 3aop A:346-425 [39508]
   Other proteins in same PDB: d3aopa3, d3aopa4
   complexed with fs4, k, po4, srm

Details for d3aopa2

PDB Entry: 3aop, 2.1 Å

PDB Description: sulfite reductase hemoprotein photoreduced with proflavine edta, siroheme feii,[4fe-4s] +1, phosphate bound

PDB Compounds: (A:) sulfite reductase hemoprotein

SCOP Domain Sequences for d3aopa2:

Sequence; same for both SEQRES and ATOM records:

>d3aopa2 d.58.36.1 (A:346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

Timeline for d3aopa2:

• d3aopa2 first appeared (with stable ids) in SCOP 1.55, called d3aop_2
  
• d3aopa2 appears in SCOP 1.73
  
• d3aopa2 appears in SCOPe 2.01
  
• d3aopa2 appears in the current release, SCOPe 2.08