SCOPe 2.08: Domain d6kypb1: 6kyp B:200-468

Lineage for d6kypb1 (6kyp B:200-468)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d6kypb1: 6kyp B:200-468 [395049]
   Other proteins in same PDB: d6kypa2, d6kypb2
   automated match to d3kdua_
   complexed with e0o, gw9

Details for d6kypb1

PDB Entry: 6kyp, 2.86 Å

PDB Description: x-ray structure of human pparalpha ligand binding domain-gw9662- clofibric acid co-crystals obtained by delipidation and co- crystallization

PDB Compounds: (B:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d6kypb1:

Sequence; same for both SEQRES and ATOM records:

>d6kypb1 a.123.1.1 (B:200-468) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tadlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvaklv
angiqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifa
mlssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfv
aaiiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvte
haqlvqiikktesdaalhpllqeiyrdmy

Timeline for d6kypb1:

• d6kypb1 first appeared in SCOPe 2.07