Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d6l9mb_: 6l9m B: [395048] Other proteins in same PDB: d6l9ma1, d6l9ma2, d6l9md1, d6l9md2, d6l9mg1, d6l9mg2, d6l9mj1, d6l9mj2 automated match to d1lk2b_ |
PDB Entry: 6l9m (more details), 2.6 Å
SCOPe Domain Sequences for d6l9mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9mb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d6l9mb_: