Lineage for d6l9mb_ (6l9m B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2745653Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2746159Domain d6l9mb_: 6l9m B: [395048]
    Other proteins in same PDB: d6l9ma1, d6l9ma2, d6l9md1, d6l9md2, d6l9mg1, d6l9mg2, d6l9mj1, d6l9mj2
    automated match to d1lk2b_

Details for d6l9mb_

PDB Entry: 6l9m (more details), 2.6 Å

PDB Description: h2-ld complexed with ah1 peptide
PDB Compounds: (B:) b2m

SCOPe Domain Sequences for d6l9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9mb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d6l9mb_:

Click to download the PDB-style file with coordinates for d6l9mb_.
(The format of our PDB-style files is described here.)

Timeline for d6l9mb_: