| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries) |
| Domain d7k5ya_: 7k5y A: [394998] Other proteins in same PDB: d7k5yb_, d7k5yc_, d7k5yd_, d7k5yf_, d7k5yg_, d7k5yh_, d7k5ym1, d7k5ym2, d7k5yn1, d7k5yn2, d7k5yu_ automated match to d1u35a1 protein/DNA complex |
PDB Entry: 7k5y (more details), 2.76 Å
SCOPe Domain Sequences for d7k5ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5ya_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirge
Timeline for d7k5ya_: