SCOPe 2.08: Domain d7kfvg2: 7kfv G:107-214

Lineage for d7kfvg2 (7kfv G:107-214)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d7kfvg2: 7kfv G:107-214 [394919]
Other proteins in same PDB: d7kfva_, d7kfvb_, d7kfvc_, d7kfvd1, d7kfve_, d7kfvf_, d7kfvg1, d7kfvh_, d7kfvl1
automated match to d1dn0a2
complexed with nag

Details for d7kfvg2

PDB Entry: 7kfv (more details), 2.1 Å

PDB Description: structural basis for a germline-biased antibody response to sars-cov-2 (rbd:c1a-b12 fab)

PDB Compounds: (G:) light chain of antibody C1A-B3 Fab

SCOPe Domain Sequences for d7kfvg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kfvg2 b.1.1.2 (G:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d7kfvg2:

Click to download the PDB-style file with coordinates for d7kfvg2.
(The format of our PDB-style files is described here.)

Timeline for d7kfvg2: