| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
| Domain d7k5xh_: 7k5x H: [394879] Other proteins in same PDB: d7k5xa_, d7k5xb_, d7k5xc_, d7k5xe_, d7k5xf_, d7k5xg_, d7k5xm1, d7k5xm2, d7k5xn1, d7k5xn2, d7k5xu_ automated match to d5b2jd_ protein/DNA complex |
PDB Entry: 7k5x (more details), 2.93 Å
SCOPe Domain Sequences for d7k5xh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5xh_ a.22.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
tsreiqtavrlllpgelakhavsegtkavtkytsa
Timeline for d7k5xh_: