Lineage for d7k5xm2 (7k5x M:150-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760524Domain d7k5xm2: 7k5x M:150-268 [394870]
    Other proteins in same PDB: d7k5xa_, d7k5xb_, d7k5xc_, d7k5xd_, d7k5xe_, d7k5xf_, d7k5xg_, d7k5xh_, d7k5xu_
    automated match to d4f9lc2
    protein/DNA complex

Details for d7k5xm2

PDB Entry: 7k5x (more details), 2.93 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.0
PDB Compounds: (M:) scFv20

SCOPe Domain Sequences for d7k5xm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k5xm2 b.1.1.0 (M:150-268) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvepgtsvkmpckasgytftsytiqwvkqtprqglewigyiypynagtky
nekfkgkatltsdkssstvymelssltsedsavyycarkssrlrstldywgqgtsvtvs

SCOPe Domain Coordinates for d7k5xm2:

Click to download the PDB-style file with coordinates for d7k5xm2.
(The format of our PDB-style files is described here.)

Timeline for d7k5xm2: