Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d7k5xm1: 7k5x M:19-126 [394869] Other proteins in same PDB: d7k5xa_, d7k5xb_, d7k5xc_, d7k5xd_, d7k5xe_, d7k5xf_, d7k5xg_, d7k5xh_, d7k5xu_ automated match to d4f9lc1 protein/DNA complex |
PDB Entry: 7k5x (more details), 2.93 Å
SCOPe Domain Sequences for d7k5xm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5xm1 b.1.1.0 (M:19-126) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mdikmtqspssmhaslgervtitckasqdirsylswyqqkpwkspktliyyatsladgvp srfsgsgsgqdfsltinnlesddtatyyclqhgespytfgsgtkleik
Timeline for d7k5xm1: