SCOPe 2.08: Domain d7k4xa_: 7k4x A:

Lineage for d7k4xa_ (7k4x A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (28 species)
   not a true protein

7. Species Thermoascus aurantiacus [TaxId:5087] [190006] (28 PDB entries)

8. Domain d7k4xa_: 7k4x A: [394863]
   automated match to d1goka_
   complexed with 6nt, act, so4

Details for d7k4xa_

PDB Entry: 7k4x, 1.6 Å

PDB Description: crystal structure of kemp eliminase hg3.7 in complex with the transition state analog 6-nitrobenzotriazole

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d7k4xa_:

Sequence; same for both SEQRES and ATOM records:

>d7k4xa_ c.1.8.3 (A:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
aaqsidqlikargkvyfgvatdqnrlttgknaaiikadfgmvwpensmqwdatepsqgnf
nfagadylvnwaqqngkligggclvwhrhlpswvssitdkntltnvmknhittlmtrykg
kirnwdvvgeafnedgslrqtvflnvigedyipiafqtaraadpnaklyimdynldsasy
pktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevsilmldva
gasptdyvnvvnaclnvqscvgitvfgvadpdswrasttpllfdgnfnpkpaynaivqdl
qq

Timeline for d7k4xa_:

• d7k4xa_ first appeared in SCOPe 2.07