Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries) |
Domain d7k60h_: 7k60 H: [394860] Other proteins in same PDB: d7k60b_, d7k60c_, d7k60f_, d7k60g_, d7k60m1, d7k60m2, d7k60n1, d7k60n2 automated match to d5b2jd_ protein/DNA complex |
PDB Entry: 7k60 (more details), 3.12 Å
SCOPe Domain Sequences for d7k60h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k60h_ a.22.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} krsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti tsreiqtavrlllpgelakhavsegtkavtkytsa
Timeline for d7k60h_: