SCOPe 2.08: Domain d7k61c_: 7k61 C:

Lineage for d7k61c_ (7k61 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (7 species)

7. Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (5 PDB entries)
   Uniprot P28001 11-118

8. Domain d7k61c_: 7k61 C: [394857]
   Other proteins in same PDB: d7k61a_, d7k61b_, d7k61d_, d7k61e_, d7k61f_, d7k61h_, d7k61m1, d7k61m2, d7k61n1, d7k61n2
   automated match to d2cv5c1
   protein/DNA complex

Details for d7k61c_

PDB Entry: 7k61, 2.85 Å

PDB Description: cryo-em structure of 197bp nucleosome aided by scfv

PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d7k61c_:

Sequence; same for both SEQRES and ATOM records:

>d7k61c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]}
arakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagna
ardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

Timeline for d7k61c_:

• d7k61c_ first appeared in SCOPe 2.07