Lineage for d7k60d_ (7k60 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312123Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries)
  8. 2312301Domain d7k60d_: 7k60 D: [394850]
    Other proteins in same PDB: d7k60b_, d7k60c_, d7k60f_, d7k60g_, d7k60m1, d7k60m2, d7k60n1, d7k60n2
    automated match to d5b2jd_
    protein/DNA complex

Details for d7k60d_

PDB Entry: 7k60 (more details), 3.12 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.10
PDB Compounds: (D:) Histone H2B type 1-J

SCOPe Domain Sequences for d7k60d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k60d_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
tsreiqtavrlllpgelakhavsegtkavtkytsa

SCOPe Domain Coordinates for d7k60d_:

Click to download the PDB-style file with coordinates for d7k60d_.
(The format of our PDB-style files is described here.)

Timeline for d7k60d_: