Lineage for d7k5ym1 (7k5y M:19-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760387Domain d7k5ym1: 7k5y M:19-126 [394838]
    Other proteins in same PDB: d7k5ya_, d7k5yb_, d7k5yc_, d7k5yd_, d7k5ye_, d7k5yf_, d7k5yg_, d7k5yh_, d7k5yu_
    automated match to d4f9lc1
    protein/DNA complex

Details for d7k5ym1

PDB Entry: 7k5y (more details), 2.76 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.4
PDB Compounds: (M:) scFv20

SCOPe Domain Sequences for d7k5ym1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k5ym1 b.1.1.0 (M:19-126) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdikmtqspssmhaslgervtitckasqdirsylswyqqkpwkspktliyyatsladgvp
srfsgsgsgqdfsltinnlesddtatyyclqhgespytfgsgtkleik

SCOPe Domain Coordinates for d7k5ym1:

Click to download the PDB-style file with coordinates for d7k5ym1.
(The format of our PDB-style files is described here.)

Timeline for d7k5ym1: