![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d7k5ym1: 7k5y M:19-126 [394838] Other proteins in same PDB: d7k5ya_, d7k5yb_, d7k5yc_, d7k5yd_, d7k5ye_, d7k5yf_, d7k5yg_, d7k5yh_, d7k5yu_ automated match to d4f9lc1 protein/DNA complex |
PDB Entry: 7k5y (more details), 2.76 Å
SCOPe Domain Sequences for d7k5ym1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5ym1 b.1.1.0 (M:19-126) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mdikmtqspssmhaslgervtitckasqdirsylswyqqkpwkspktliyyatsladgvp srfsgsgsgqdfsltinnlesddtatyyclqhgespytfgsgtkleik
Timeline for d7k5ym1: