SCOPe 2.07: Domain d7k37k1: 7k37 K:2-110

Lineage for d7k37k1 (7k37 K:2-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7k37k1: 7k37 K:2-110 [394833]
   Other proteins in same PDB: d7k37a_, d7k37b_, d7k37c_, d7k37d_, d7k37e_, d7k37f_
   automated match to d4ocrl1
   complexed with nag

Details for d7k37k1

PDB Entry: 7k37, 2.8 Å

PDB Description: structure of full-length influenza ha with a head-binding antibody at ph 7.8

PDB Compounds: (K:) antibody fab light chain

SCOPe Domain Sequences for d7k37k1:

Sequence, based on SEQRES records:

>d7k37k1 b.1.1.0 (K:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgsssnigagyavhwyqqlpgtapkllisgnsnrpsgvp
drfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltv

Sequence, based on observed residues (ATOM records):

>d7k37k1 b.1.1.0 (K:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgssavhwyqqlpgtapkllisgnsnrpsgvpdrfsgsk
sgtsaslaitglqaedeadyycqssvfgggtkltv

Timeline for d7k37k1:

• d7k37k1 is new in SCOPe 2.07-stable
  
• d7k37k1 appears in the current release, SCOPe 2.08