SCOPe 2.07: Domain d7k5xn2: 7k5x N:150-268

Lineage for d7k5xn2 (7k5x N:150-268)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d7k5xn2: 7k5x N:150-268 [394828]
   Other proteins in same PDB: d7k5xa_, d7k5xb_, d7k5xc_, d7k5xd_, d7k5xe_, d7k5xf_, d7k5xg_, d7k5xh_, d7k5xu_
   automated match to d4f9lc2
   protein/DNA complex

Details for d7k5xn2

PDB Entry: 7k5x, 2.93 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.0

PDB Compounds: (N:) scFv20

SCOPe Domain Sequences for d7k5xn2:

Sequence; same for both SEQRES and ATOM records:

>d7k5xn2 b.1.1.0 (N:150-268) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvepgtsvkmpckasgytftsytiqwvkqtprqglewigyiypynagtky
nekfkgkatltsdkssstvymelssltsedsavyycarkssrlrstldywgqgtsvtvs

Timeline for d7k5xn2:

• d7k5xn2 is new in SCOPe 2.07-stable
  
• d7k5xn2 appears in the current release, SCOPe 2.08