Lineage for d1diib1 (1dii B:243-521)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192916Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (3 families) (S)
  5. 192917Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)
  6. 192918Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
  7. 192919Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries)
  8. 192923Domain d1diib1: 1dii B:243-521 [39482]
    Other proteins in same PDB: d1diia2, d1diib2, d1diic_, d1diid_

Details for d1diib1

PDB Entry: 1dii (more details), 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution

SCOP Domain Sequences for d1diib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diib1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

SCOP Domain Coordinates for d1diib1:

Click to download the PDB-style file with coordinates for d1diib1.
(The format of our PDB-style files is described here.)

Timeline for d1diib1: