Lineage for d1diia1 (1dii A:243-521)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562051Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562052Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
    the other subunit is a short-chain cytochrome c
  7. Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries)
  8. 2562057Domain d1diia1: 1dii A:243-521 [39481]
    Other proteins in same PDB: d1diia2, d1diib2, d1diic_, d1diid_
    complexed with cl, fad, hem

Details for d1diia1

PDB Entry: 1dii (more details), 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution
PDB Compounds: (A:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diia1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

SCOPe Domain Coordinates for d1diia1:

Click to download the PDB-style file with coordinates for d1diia1.
(The format of our PDB-style files is described here.)

Timeline for d1diia1: