Lineage for d1diqb1 (1diq B:243-521)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33122Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (2 families) (S)
  5. 33123Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)
  6. 33124Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
  7. 33125Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries)
  8. 33127Domain d1diqb1: 1diq B:243-521 [39480]
    Other proteins in same PDB: d1diqa2, d1diqb2, d1diqc_, d1diqd_

Details for d1diqb1

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

SCOP Domain Sequences for d1diqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqb1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

SCOP Domain Coordinates for d1diqb1:

Click to download the PDB-style file with coordinates for d1diqb1.
(The format of our PDB-style files is described here.)

Timeline for d1diqb1: