Lineage for d1diqb1 (1diq B:243-521)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955209Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955210Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
    the other subunit is a short-chain cytochrome c
  7. Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries)
  8. 2955216Domain d1diqb1: 1diq B:243-521 [39480]
    Other proteins in same PDB: d1diqa2, d1diqb2, d1diqc_, d1diqd_
    complexed with cl, fad, hec, pcr

Details for d1diqb1

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound
PDB Compounds: (B:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqb1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

SCOPe Domain Coordinates for d1diqb1:

Click to download the PDB-style file with coordinates for d1diqb1.
(The format of our PDB-style files is described here.)

Timeline for d1diqb1: