Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (6 species) |
Species Mouse (Mus musculus), H3.1 [TaxId:10090] [140395] (6 PDB entries) Uniprot P68433 38-135 |
Domain d7k5xe_: 7k5x E: [394793] Other proteins in same PDB: d7k5xb_, d7k5xc_, d7k5xd_, d7k5xf_, d7k5xg_, d7k5xh_, d7k5xm1, d7k5xm2, d7k5xn1, d7k5xn2, d7k5xu_ automated match to d1u35a1 protein/DNA complex |
PDB Entry: 7k5x (more details), 2.93 Å
SCOPe Domain Sequences for d7k5xe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5xe_ a.22.1.1 (E:) Histone H3 {Mouse (Mus musculus), H3.1 [TaxId: 10090]} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac eaylvglfedtnlcaihakrvtimpkdiqlarrirge
Timeline for d7k5xe_: