Lineage for d1diqa1 (1diq A:243-521)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604934Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families) (S)
    duplication: contains two subdomains of this fold
  5. 604935Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)
  6. 604936Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
    the other subunit is a short-chain cytochrome c
  7. 604937Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries)
  8. 604938Domain d1diqa1: 1diq A:243-521 [39479]
    Other proteins in same PDB: d1diqa2, d1diqb2, d1diqc_, d1diqd_

Details for d1diqa1

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

SCOP Domain Sequences for d1diqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

SCOP Domain Coordinates for d1diqa1:

Click to download the PDB-style file with coordinates for d1diqa1.
(The format of our PDB-style files is described here.)

Timeline for d1diqa1: