![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (3 families) ![]() |
![]() | Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins) |
![]() | Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [55108] (2 PDB entries) |
![]() | Domain d1diqa1: 1diq A:243-521 [39479] Other proteins in same PDB: d1diqa2, d1diqb2, d1diqc_, d1diqd_ |
PDB Entry: 1diq (more details), 2.75 Å
SCOP Domain Sequences for d1diqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diqa1 d.58.32.1 (A:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida} pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr vaqsygpvkrklehaikravdpnnilapgrsgidlnndf
Timeline for d1diqa1:
![]() Domains from other chains: (mouse over for more information) d1diqb1, d1diqb2, d1diqc_, d1diqd_ |