Lineage for d7k5yd_ (7k5y D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312123Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries)
  8. 2312219Domain d7k5yd_: 7k5y D: [394778]
    Other proteins in same PDB: d7k5ya_, d7k5yb_, d7k5yc_, d7k5ye_, d7k5yf_, d7k5yg_, d7k5ym1, d7k5ym2, d7k5yn1, d7k5yn2, d7k5yu_
    automated match to d5b2jd_
    protein/DNA complex

Details for d7k5yd_

PDB Entry: 7k5y (more details), 2.76 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.4
PDB Compounds: (D:) Histone H2B type 1-J

SCOPe Domain Sequences for d7k5yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k5yd_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
tsreiqtavrlllpgelakhavsegtkavtkytsa

SCOPe Domain Coordinates for d7k5yd_:

Click to download the PDB-style file with coordinates for d7k5yd_.
(The format of our PDB-style files is described here.)

Timeline for d7k5yd_: