![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species Mouse (Mus musculus), H3.1 [TaxId:10090] [140395] (6 PDB entries) Uniprot P68433 38-135 |
![]() | Domain d7k5ye_: 7k5y E: [394773] Other proteins in same PDB: d7k5yb_, d7k5yc_, d7k5yd_, d7k5yf_, d7k5yg_, d7k5yh_, d7k5ym1, d7k5ym2, d7k5yn1, d7k5yn2, d7k5yu_ automated match to d1u35a1 protein/DNA complex |
PDB Entry: 7k5y (more details), 2.76 Å
SCOPe Domain Sequences for d7k5ye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5ye_ a.22.1.1 (E:) Histone H3 {Mouse (Mus musculus), H3.1 [TaxId: 10090]} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac eaylvglfedtnlcaihakrvtimpkdiqlarrirge
Timeline for d7k5ye_: