Lineage for d7k5ye_ (7k5y E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311654Protein Histone H3 [47122] (6 species)
  7. 2311776Species Mouse (Mus musculus), H3.1 [TaxId:10090] [140395] (6 PDB entries)
    Uniprot P68433 38-135
  8. 2311780Domain d7k5ye_: 7k5y E: [394773]
    Other proteins in same PDB: d7k5yb_, d7k5yc_, d7k5yd_, d7k5yf_, d7k5yg_, d7k5yh_, d7k5ym1, d7k5ym2, d7k5yn1, d7k5yn2, d7k5yu_
    automated match to d1u35a1
    protein/DNA complex

Details for d7k5ye_

PDB Entry: 7k5y (more details), 2.76 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.4
PDB Compounds: (E:) Histone H3.1

SCOPe Domain Sequences for d7k5ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k5ye_ a.22.1.1 (E:) Histone H3 {Mouse (Mus musculus), H3.1 [TaxId: 10090]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirge

SCOPe Domain Coordinates for d7k5ye_:

Click to download the PDB-style file with coordinates for d7k5ye_.
(The format of our PDB-style files is described here.)

Timeline for d7k5ye_: