Lineage for d7k5yu_ (7k5y U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308186Species Human (Homo sapiens) [TaxId:9606] [186924] (22 PDB entries)
  8. 2308210Domain d7k5yu_: 7k5y U: [394772]
    Other proteins in same PDB: d7k5ya_, d7k5yb_, d7k5yc_, d7k5yd_, d7k5ye_, d7k5yf_, d7k5yg_, d7k5yh_, d7k5ym1, d7k5ym2, d7k5yn1, d7k5yn2
    automated match to d1ghca_
    protein/DNA complex

Details for d7k5yu_

PDB Entry: 7k5y (more details), 2.76 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.4
PDB Compounds: (U:) Histone H1.4

SCOPe Domain Sequences for d7k5yu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k5yu_ a.4.5.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgppvselitkavaaskersgvslaalkkalaaagydveknnsriklglkslvskgtlvq
tkgtgasgsfklnkk

SCOPe Domain Coordinates for d7k5yu_:

Click to download the PDB-style file with coordinates for d7k5yu_.
(The format of our PDB-style files is described here.)

Timeline for d7k5yu_: