Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (22 PDB entries) |
Domain d7k5yu_: 7k5y U: [394772] Other proteins in same PDB: d7k5ya_, d7k5yb_, d7k5yc_, d7k5yd_, d7k5ye_, d7k5yf_, d7k5yg_, d7k5yh_, d7k5ym1, d7k5ym2, d7k5yn1, d7k5yn2 automated match to d1ghca_ protein/DNA complex |
PDB Entry: 7k5y (more details), 2.76 Å
SCOPe Domain Sequences for d7k5yu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5yu_ a.4.5.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sgppvselitkavaaskersgvslaalkkalaaagydveknnsriklglkslvskgtlvq tkgtgasgsfklnkk
Timeline for d7k5yu_: