Lineage for d1ahza1 (1ahz A:274-560)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955209Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955210Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. 2955217Protein Vanillyl-alcohol oxidase [55105] (1 species)
  7. 2955218Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (16 PDB entries)
    Uniprot P56216
  8. 2955243Domain d1ahza1: 1ahz A:274-560 [39477]
    Other proteins in same PDB: d1ahza2, d1ahzb2
    complexed with cl, ept, fad

Details for d1ahza1

PDB Entry: 1ahz (more details), 3.3 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with 4-(1-heptenyl)phenol
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1ahza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahza1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOPe Domain Coordinates for d1ahza1:

Click to download the PDB-style file with coordinates for d1ahza1.
(The format of our PDB-style files is described here.)

Timeline for d1ahza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ahza2