Lineage for d7k39e_ (7k39 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385289Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)
  8. 2385572Domain d7k39e_: 7k39 E: [394763]
    Other proteins in same PDB: d7k39b_, d7k39d_, d7k39f_, d7k39g1, d7k39g2, d7k39i1, d7k39i2, d7k39k1, d7k39k2
    automated match to d2hmga_
    complexed with nag

Details for d7k39e_

PDB Entry: 7k39 (more details), 3 Å

PDB Description: structure of full-length influenza ha with a head-binding antibody at ph 5.2, conformation a, neutral ph-like
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d7k39e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k39e_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpek

SCOPe Domain Coordinates for d7k39e_:

Click to download the PDB-style file with coordinates for d7k39e_.
(The format of our PDB-style files is described here.)

Timeline for d7k39e_: