Lineage for d7k7cb1 (7k7c B:4-187)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000791Species Corynebacterium diphtheriae [TaxId:1717] [256176] (7 PDB entries)
  8. 3000796Domain d7k7cb1: 7k7c B:4-187 [394740]
    Other proteins in same PDB: d7k7ca2, d7k7ca3, d7k7ca4, d7k7cb2, d7k7cb3, d7k7cb4
    automated match to d1f0la2

Details for d7k7cb1

PDB Entry: 7k7c (more details), 2.05 Å

PDB Description: crystal structure of diphtheria toxin from crystals obtained at ph 5.5
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d7k7cb1:

Sequence, based on SEQRES records: (download)

>d7k7cb1 d.166.1.0 (B:4-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
dvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwegfystdnkydaa
gysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteef
ikrfgdgasrvvlslpfaegsssvkyinnweqakalsveleinfetrgkrgqdamyeyma
qaca

Sequence, based on observed residues (ATOM records): (download)

>d7k7cb1 d.166.1.0 (B:4-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
dvvdssksfvmenfssyhgtkpgyvdsiqkgiqkddwegfystdnkydaagysvdnenpl
sgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikrfgdgasr
vvlslpfaegsssvkyinnweqakalsveleinfetrgkrgqdamyeymaqaca

SCOPe Domain Coordinates for d7k7cb1:

Click to download the PDB-style file with coordinates for d7k7cb1.
(The format of our PDB-style files is described here.)

Timeline for d7k7cb1: