SCOPe 2.08: Domain d7k5yg_: 7k5y G:

Lineage for d7k5yg_ (7k5y G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (7 species)

7. Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (5 PDB entries)
   Uniprot P28001 11-118

8. Domain d7k5yg_: 7k5y G: [394734]
   Other proteins in same PDB: d7k5ya_, d7k5yb_, d7k5yd_, d7k5ye_, d7k5yf_, d7k5yh_, d7k5ym1, d7k5ym2, d7k5yn1, d7k5yn2, d7k5yu_
   automated match to d2cv5c1
   protein/DNA complex

Details for d7k5yg_

PDB Entry: 7k5y, 2.76 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.4

PDB Compounds: (G:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d7k5yg_:

Sequence; same for both SEQRES and ATOM records:

>d7k5yg_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]}
arakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagna
ardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

Timeline for d7k5yg_:

• d7k5yg_ first appeared in SCOPe 2.07