Lineage for d2vaoa1 (2vao A:274-560)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955209Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955210Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. 2955217Protein Vanillyl-alcohol oxidase [55105] (1 species)
  7. 2955218Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (16 PDB entries)
    Uniprot P56216
  8. 2955241Domain d2vaoa1: 2vao A:274-560 [39473]
    Other proteins in same PDB: d2vaoa2, d2vaob2
    complexed with eug, fad

Details for d2vaoa1

PDB Entry: 2vao (more details), 2.8 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with isoeugenol
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d2vaoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vaoa1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOPe Domain Coordinates for d2vaoa1:

Click to download the PDB-style file with coordinates for d2vaoa1.
(The format of our PDB-style files is described here.)

Timeline for d2vaoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vaoa2