Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
Domain d7k63d_: 7k63 D: [394729] Other proteins in same PDB: d7k63b_, d7k63c_, d7k63f_, d7k63g_, d7k63m1, d7k63m2, d7k63n1, d7k63n2, d7k63u_ automated match to d5b2jd_ protein/DNA complex |
PDB Entry: 7k63 (more details), 3.03 Å
SCOPe Domain Sequences for d7k63d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k63d_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} krsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti tsreiqtavrlllpgelakhavsegtkavtkytsa
Timeline for d7k63d_: