Lineage for d7k39c_ (7k39 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775934Domain d7k39c_: 7k39 C: [394727]
    Other proteins in same PDB: d7k39b_, d7k39d_, d7k39f_, d7k39g1, d7k39g2, d7k39h_, d7k39i1, d7k39i2, d7k39j_, d7k39k1, d7k39k2, d7k39l_
    automated match to d2hmga_
    complexed with nag

Details for d7k39c_

PDB Entry: 7k39 (more details), 3 Å

PDB Description: structure of full-length influenza ha with a head-binding antibody at ph 5.2, conformation a, neutral ph-like
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d7k39c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k39c_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpek

SCOPe Domain Coordinates for d7k39c_:

Click to download the PDB-style file with coordinates for d7k39c_.
(The format of our PDB-style files is described here.)

Timeline for d7k39c_: