Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries) |
Domain d7k63g_: 7k63 G: [394724] Other proteins in same PDB: d7k63b_, d7k63d_, d7k63f_, d7k63h_, d7k63m1, d7k63m2, d7k63n1, d7k63n2 automated match to d1m1ac_ protein/DNA complex |
PDB Entry: 7k63 (more details), 3.03 Å
SCOPe Domain Sequences for d7k63g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k63g_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]} arakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagna ardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
Timeline for d7k63g_: