Lineage for d7k63g_ (7k63 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698058Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries)
  8. 2698110Domain d7k63g_: 7k63 G: [394724]
    Other proteins in same PDB: d7k63b_, d7k63d_, d7k63f_, d7k63h_, d7k63m1, d7k63m2, d7k63n1, d7k63n2, d7k63u_
    automated match to d1m1ac_
    protein/DNA complex

Details for d7k63g_

PDB Entry: 7k63 (more details), 3.03 Å

PDB Description: cryo-em structure of a chromatosome containing chimeric linker histone gh1.10-nch1.4
PDB Compounds: (G:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d7k63g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k63g_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
arakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagna
ardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d7k63g_:

Click to download the PDB-style file with coordinates for d7k63g_.
(The format of our PDB-style files is described here.)

Timeline for d7k63g_: