SCOPe 2.08: Domain d7k9za1: 7k9z A:1-106

Lineage for d7k9za1 (7k9z A:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7k9za1: 7k9z A:1-106 [394721]
   Other proteins in same PDB: d7k9za2, d7k9ze_, d7k9zl2
   automated match to d1dn0a1
   complexed with nag

Details for d7k9za1

PDB Entry: 7k9z, 2.95 Å

PDB Description: crystal structure of sars-cov-2 receptor binding domain in complex with the fab fragments of neutralizing antibodies 298 and 52

PDB Compounds: (A:) 298 Fab Light Chain

SCOPe Domain Sequences for d7k9za1:

Sequence; same for both SEQRES and ATOM records:

>d7k9za1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpptfgqgtklei

Timeline for d7k9za1:

• d7k9za1 first appeared in SCOPe 2.07