SCOP 1.73: Domain d1ahub1: 1ahu B:274-560

Lineage for d1ahub1 (1ahu B:274-560)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)

6. Protein Vanillyl-alcohol oxidase [55105] (1 species)

7. Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (16 PDB entries)

8. Domain d1ahub1: 1ahu B:274-560 [39470]
   Other proteins in same PDB: d1ahua2, d1ahub2
   complexed with faa

Details for d1ahub1

PDB Entry: 1ahu, 2.7 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with p-cresol

PDB Compounds: (B:) vanillyl-alcohol oxidase

SCOP Domain Sequences for d1ahub1:

Sequence; same for both SEQRES and ATOM records:

>d1ahub1 d.58.32.1 (B:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

Timeline for d1ahub1:

• d1ahub1 first appeared (with stable ids) in SCOP 1.55
  
• d1ahub1 appears in SCOP 1.71
  
• d1ahub1 appears in SCOP 1.75
  
• d1ahub1 appears in the current release, SCOPe 2.08