Lineage for d1ahub1 (1ahu B:274-560)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33122Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (2 families) (S)
  5. 33123Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)
  6. 33130Protein Vanillyl-alcohol oxidase [55105] (1 species)
  7. 33131Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (12 PDB entries)
  8. 33147Domain d1ahub1: 1ahu B:274-560 [39470]
    Other proteins in same PDB: d1ahua2, d1ahub2

Details for d1ahub1

PDB Entry: 1ahu (more details), 2.7 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with p-cresol

SCOP Domain Sequences for d1ahub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahub1 d.58.32.1 (B:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOP Domain Coordinates for d1ahub1:

Click to download the PDB-style file with coordinates for d1ahub1.
(The format of our PDB-style files is described here.)

Timeline for d1ahub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ahub2