Lineage for d7k5xg_ (7k5x G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698159Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (5 PDB entries)
    Uniprot P28001 11-118
  8. 2698167Domain d7k5xg_: 7k5x G: [394697]
    Other proteins in same PDB: d7k5xa_, d7k5xb_, d7k5xd_, d7k5xe_, d7k5xf_, d7k5xh_, d7k5xm1, d7k5xm2, d7k5xn1, d7k5xn2, d7k5xu_
    automated match to d2cv5c1
    protein/DNA complex

Details for d7k5xg_

PDB Entry: 7k5x (more details), 2.93 Å

PDB Description: cryo-em structure of a chromatosome containing human linker histone h1.0
PDB Compounds: (G:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d7k5xg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k5xg_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]}
arakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagna
ardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d7k5xg_:

Click to download the PDB-style file with coordinates for d7k5xg_.
(The format of our PDB-style files is described here.)

Timeline for d7k5xg_: