![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2A [47115] (7 species) |
![]() | Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (5 PDB entries) Uniprot P28001 11-118 |
![]() | Domain d7k5xg_: 7k5x G: [394697] Other proteins in same PDB: d7k5xa_, d7k5xb_, d7k5xd_, d7k5xe_, d7k5xf_, d7k5xh_, d7k5xm1, d7k5xm2, d7k5xn1, d7k5xn2, d7k5xu_ automated match to d2cv5c1 protein/DNA complex |
PDB Entry: 7k5x (more details), 2.93 Å
SCOPe Domain Sequences for d7k5xg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k5xg_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]} arakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagna ardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
Timeline for d7k5xg_: