Lineage for d1e0yb1 (1e0y B:274-560)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198038Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2198039Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. 2198046Protein Vanillyl-alcohol oxidase [55105] (1 species)
  7. 2198047Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (16 PDB entries)
    Uniprot P56216
  8. 2198067Domain d1e0yb1: 1e0y B:274-560 [39468]
    Other proteins in same PDB: d1e0ya2, d1e0yb2
    complexed with fad, fcr; mutant

Details for d1e0yb1

PDB Entry: 1e0y (more details), 2.75 Å

PDB Description: structure of the d170s/t457e double mutant of vanillyl-alcohol oxidase
PDB Compounds: (B:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1e0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0yb1 d.58.32.1 (B:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
ggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figeftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOPe Domain Coordinates for d1e0yb1:

Click to download the PDB-style file with coordinates for d1e0yb1.
(The format of our PDB-style files is described here.)

Timeline for d1e0yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e0yb2