Lineage for d1ahva1 (1ahv A:274-560)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. Protein Vanillyl-alcohol oxidase [55105] (1 species)
  7. Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (16 PDB entries)
    Uniprot P56216
  8. Domain d1ahva1: 1ahv A:274-560 [39463]
    Other proteins in same PDB: d1ahva2, d1ahvb2
    complexed with fad, ncr

Details for d1ahva1

PDB Entry: 1ahv (more details), 3.1 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with 2-nitro-p-cresol
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1ahva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahva1 d.58.32.1 (A:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOPe Domain Coordinates for d1ahva1 are not available.

Timeline for d1ahva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ahva2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ahvb1, d1ahvb2